Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Elongation factor Ts (tsf)

Product Specifications

Product Name Alternative

Bacteriophage Q beta RNA-directed RNA polymerase subunit IV

Abbreviation

Recombinant E.coli tsf protein

Gene Name

Tsf

UniProt

P0A6P1

Expression Region

2-283aa

Organism

Escherichia coli (strain K12)

Target Sequence

AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.138.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNA1 Protein (C-His, Human)
P524058 100 µg

EFNA1 Protein (C-His, Human)

Sign In for Pricing
View Details
Goat anti Rat IgG (H + L)
41R-1087 2 mg

Goat anti Rat IgG (H + L)

Sign In for Pricing
View Details
Anti-CAT4 Antibody
MBS9240084-01 0.05 mL

Anti-CAT4 Antibody

Sign In for Pricing
View Details
Anti-CAT4 Antibody
MBS9240084-02 0.1 mL

Anti-CAT4 Antibody

Sign In for Pricing
View Details
Anti-CAT4 Antibody
MBS9240084-03 5x 0.1 mL

Anti-CAT4 Antibody

Sign In for Pricing
View Details
Goat Arginine Decarboxylase (ADC) ELISA Kit
MBS9351303 Inquire

Goat Arginine Decarboxylase (ADC) ELISA Kit

Sign In for Pricing
View Details