Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sterol regulatory element-binding protein 1 (SREBF1), partial, Biotinylated

Product Specifications

Product Name Alternative

Class D basic helix-loop-helix protein 1; Sterol regulatory element-binding transcription factor 1

Abbreviation

Recombinant Human SREBF1 protein, partial, Biotinylated

Gene Name

SREBF1

UniProt

P36956

Expression Region

1-487aa

Organism

Homo sapiens (Human)

Target Sequence

MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSR

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.111.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

98.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAU159
MBS131956 Inquire

LAU159

Sign In for Pricing
View Details
Tnni1 (NM_001112702) Mouse Recombinant Protein
PM48489M5 20 µg

Tnni1 (NM_001112702) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human FNDC8 shRNA (UAS) - Lentiviral human FNDC8 shRNA (UAS, RFP) (100)
GTR15100176 1 Vial

Lentiviral human FNDC8 shRNA (UAS) - Lentiviral human FNDC8 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TRH Rabbit pAb
E47R0357 100 µL

TRH Rabbit pAb

Sign In for Pricing
View Details
1- (3,3,3-Trifluoropropyl) -1H-pyrazol-5-amine
VZB77293-01 50 mg

1- (3,3,3-Trifluoropropyl) -1H-pyrazol-5-amine

Sign In for Pricing
View Details
1- (3,3,3-Trifluoropropyl) -1H-pyrazol-5-amine
VZB77293-02 0.5 g

1- (3,3,3-Trifluoropropyl) -1H-pyrazol-5-amine

Sign In for Pricing
View Details