Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Androgen receptor (AR), partial

Product Specifications

Product Name Alternative

Dihydrotestosterone receptor; Nuclear receptor subfamily 3 group C member 4

Abbreviation

Recombinant Human AR protein, partial

Gene Name

AR

UniProt

P10275

Expression Region

551-919aa

Organism

Homo sapiens (Human)

Target Sequence

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins like ZBTB7A that recruits NCOR1 and NCOR2 to the androgen response elements/ARE on target genes, negatively regulating androgen receptor signaling and androgen-induced cell proliferation. Transcription activation is also down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.107.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a35 Mouse Gene Knockout Kit (CRISPR)
KN515982 1 Kit

Slc25a35 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P2Y12 Recombinant Chimeric Antibody Antibody
HA610231 100 µg

P2Y12 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
EMX1 Rabbit Polyclonal Antibody
TA375890 100 µL

EMX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Aminophenylphosphorylcholine
TRC-A626000-25MG 25 mg

4-Aminophenylphosphorylcholine

Sign In for Pricing
View Details
Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (20-50ug) labeling
#92580 1 Kit

Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Human MADM (NRBP1) activation kit by CRISPRa
GA109343 1 Kit

Human MADM (NRBP1) activation kit by CRISPRa

Sign In for Pricing
View Details