Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Abbreviation

Recombinant Bovine EGF protein, partial

Gene Name

EGF

UniProt

XP_024849546.1

Expression Region

971-1023aa

Organism

Bos taurus (Bovine)

Target Sequence

DSTLLSHLGKNGHNFLKKCFPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.104.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam187a (NM_025766) Mouse Tagged ORF Clone Lentiviral Particle
MR222455L3V 200 µL

Fam187a (NM_025766) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SNORD56 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2230205 3x 1.0 µg

SNORD56 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti-EAA1 antibody
SL12560R-01 50 µL

Rabbit Anti-EAA1 antibody

Sign In for Pricing
View Details
Rabbit Anti-EAA1 antibody
SL12560R-02 100 µL

Rabbit Anti-EAA1 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal BTG4 Antibody [DyLight 550]
NBP3-05926R 0.1 mL

Rabbit Polyclonal BTG4 Antibody [DyLight 550]

Sign In for Pricing
View Details
BPIL1, NT (RYSR, Long Palate, Lung And Nasal Epithelium Carcinoma-associated Protein 2, Bactericidal/Permeability-increasing Protein-like 1, C20orf184, LPLUNC2, UNQ2489/PRO5776) (HRP)
MBS6464694-01 0.2 mL

BPIL1, NT (RYSR, Long Palate, Lung And Nasal Epithelium Carcinoma-associated Protein 2, Bactericidal/Permeability-increasing Protein-like 1, C20orf184, LPLUNC2, UNQ2489/PRO5776) (HRP)

Sign In for Pricing
View Details