Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Non-specific lipid-transfer protein

Product Specifications

Abbreviation

Recombinant Arachis hypogaea Non-specific lipid-transfer protein

UniProt

B6CEX8

Expression Region

25-116aa

Organism

Arachis hypogaea (Peanut)

Target Sequence

ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.97.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MASA Antibody
NBP2-17226 0.1 mL

Rabbit Polyclonal MASA Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus splB Protein (aa 37-240) (strain MSSA476)
VAng-Cr6446-50gEcoli 50 µg (E. coli)

Recombinant Staphylococcus Aureus splB Protein (aa 37-240) (strain MSSA476)

Sign In for Pricing
View Details
S100g sgRNA CRISPR Lentivector (Rat) (Target 1)
K6866802 1.0 µg DNA

S100g sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human PTGER4 knockout cell line
ABC-KH12375 1 Vial

Human PTGER4 knockout cell line

Sign In for Pricing
View Details
Bex1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6470206 1.0 µg DNA

Bex1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
EXT2 Antibody, Biotin conjugated
A64765-50UG 50 µg

EXT2 Antibody, Biotin conjugated

Sign In for Pricing
View Details