Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Peamaclein

Product Specifications

Abbreviation

Recombinant Prunus persica Peamaclein protein

UniProt

P86888

Expression Region

1-63aa

Organism

Prunus persica (Peach) (Amygdalus persica)

Target Sequence

GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.95.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAV1 Peptide
DF9694-BP 1 mg

NAV1 Peptide

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD32 Antibody[IV-3]
E-AB-F1075L-01 20 Tests

Elab Fluor® 488 Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD32 Antibody[IV-3]
E-AB-F1075L-02 100 Tests

Elab Fluor® 488 Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD32 Antibody[IV-3]
E-AB-F1075L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details
CYB561D1 (NM_001134400) Human Tagged ORF Clone Lentiviral Particle
RC225323L4V 200 µL

CYB561D1 (NM_001134400) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TGIF2P1 Protein Vector (Human) (pPB-N-His)
PV135567 500 ng

TGIF2P1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details