Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Osteopontin (SPP1), partial

Product Specifications

Product Name Alternative

Bone sialoprotein 1; Nephropontin; Secreted phosphoprotein 1; Urinary stone protein; Uropontin

Abbreviation

Recombinant Human SPP1 protein, partial

Gene Name

SPP1

UniProt

P10451

Expression Region

17-167aa

Organism

Homo sapiens (Human)

Target Sequence

IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGL

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Major non-collagenous bone protein that binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.81.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPH1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV699624 1.0 µg DNA

TPH1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)
MBS1285941-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)
MBS1285941-02 0.02 mg (Yeast)

Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)
MBS1285941-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)
MBS1285941-04 0.1 mg (Yeast)

Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)
MBS1285941-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O6:K15:H31 Pyrimidine monooxygenase RutA (rutA)

Sign In for Pricing
View Details