Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-23 subunit alpha (IL23A), Biotinylated

Product Specifications

Product Name Alternative

Interleukin-23 subunit p19

Abbreviation

Recombinant Human IL23A protein, Biotinylated

Gene Name

IL23A

UniProt

Q9NPF7

Expression Region

20-189aa

Organism

Homo sapiens (Human)

Target Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Associates with IL12B to form the pro-inflammatory cytokine IL-23 that plays different roles in innate and adaptive immunity. Released by antigen-presenting cells such as dendritic cells or macrophages, binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R to activate JAK2 and TYK2 which then phosphorylate the receptor to form a docking site leading to the phosphorylation of STAT3 and STAT4. This process leads to activation of several pathways including p38 MAPK or NF-kappa-B and promotes the production of pro-inflammatory cytokines such as interleukin-17A/IL17A. In turn, participates in the early and effective intracellular bacterial clearance. Promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset that produces IL-17, as well as other IL-17-producing cells

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.78.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

66.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CK2 inhibitor
B2935-5 5 mg

CK2 inhibitor

Sign In for Pricing
View Details
Anti-FITC, Purified (Clone F4/1) (mouse IgG1)
MBS520533-01 0.25 mg

Anti-FITC, Purified (Clone F4/1) (mouse IgG1)

Sign In for Pricing
View Details
Anti-FITC, Purified (Clone F4/1) (mouse IgG1)
MBS520533-02 5x 0.25 mg

Anti-FITC, Purified (Clone F4/1) (mouse IgG1)

Sign In for Pricing
View Details
Olfr748 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4165603 1.0 µg DNA

Olfr748 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Tnfsf18 (NM_183391) Mouse Tagged ORF Clone
MG224279 10 µg

Tnfsf18 (NM_183391) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Niraparib Impurity 16
RM-N090116-01 10 mg

Niraparib Impurity 16

Sign In for Pricing
View Details