Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated

Product Specifications

Abbreviation

Recombinant Clostridium pasteurianum Rubredoxin protein, Biotinylated

UniProt

P00268

Expression Region

1-54aa

Organism

Clostridium pasteurianum

Target Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.77.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary: bilateral
CR560582 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
A830010M20Rik Mouse Gene Knockout Kit (CRISPR)
KN500566 1 Kit

A830010M20Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dichloroacetic anhydride
TRC-D189760-500MG 500 mg

Dichloroacetic anhydride

Sign In for Pricing
View Details
ETV6 (NM_001987) Human Recombinant Protein
TP308185M 100 µg

ETV6 (NM_001987) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS624798 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF488A conjugate, 0.1mg/mL
BNC881878-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details