Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated

Product Specifications

Abbreviation

Recombinant Clostridium pasteurianum Rubredoxin protein, Biotinylated

UniProt

P00268

Expression Region

1-54aa

Organism

Clostridium pasteurianum

Target Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.77.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF6 Recombinant Rabbit Monoclonal Antibody [JF101-2]
ET1702-91 100 µL

ARF6 Recombinant Rabbit Monoclonal Antibody [JF101-2]

Sign In for Pricing
View Details
MASP1 (NM_139125) Human Recombinant Protein
TP321839 20 µg

MASP1 (NM_139125) Human Recombinant Protein

Sign In for Pricing
View Details
OR5H6 Antibody
8G640-AAT 50 µg

OR5H6 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800405 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Recombinant CITED2 Antibody
RC-15238-01 50 μL

Recombinant CITED2 Antibody

Sign In for Pricing
View Details
Recombinant CITED2 Antibody
RC-15238-02 100 µL

Recombinant CITED2 Antibody

Sign In for Pricing
View Details