Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Product Specifications

Product Name Alternative

IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor

Abbreviation

Recombinant Human IGFBP7 protein

Gene Name

IGFBP7

UniProt

Q16270

Expression Region

27-282aa

Organism

Homo sapiens (Human)

Target Sequence

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Binds IGF1 and IGF2 with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion. Acts as a ligand for CD93 to play a role in angiogenesis

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.63.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGDN Antibody
KC-2590-01 50 μL

NGDN Antibody

Sign In for Pricing
View Details
NGDN Antibody
KC-2590-02 100 µL

NGDN Antibody

Sign In for Pricing
View Details
NGDN Antibody
KC-2590-03 1 mL

NGDN Antibody

Sign In for Pricing
View Details
S100 alpha 6 Recombinant Rabbit Monoclonal Antibody [JF0976]
ET1702-28 100 µL

S100 alpha 6 Recombinant Rabbit Monoclonal Antibody [JF0976]

Sign In for Pricing
View Details
SIGLEC1 Antibody
KC-26953-01 50 μL

SIGLEC1 Antibody

Sign In for Pricing
View Details
SIGLEC1 Antibody
KC-26953-02 100 µL

SIGLEC1 Antibody

Sign In for Pricing
View Details