Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prolactin (Prl)

Product Specifications

Abbreviation

Recombinant Mouse Prl protein

Gene Name

Prl

UniProt

P06879

Expression Region

30-226aa

Organism

Mus musculus (Mouse)

Target Sequence

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Prolactin acts primarily on the mammary gland by promoting lactation

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.54.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit
MBS286597-01 48 Tests

Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit

Sign In for Pricing
View Details
Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit
MBS286597-02 96 Tests

Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit

Sign In for Pricing
View Details
Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit
MBS286597-03 5x 96 Tests

Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit

Sign In for Pricing
View Details
Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit
MBS286597-04 10x 96 Tests

Human Palmitoyltransferase ZDHHC2 (ZDHHC2) ELISA Kit

Sign In for Pricing
View Details
MGST1 Knockout Raji Polyclonal Cells
ARG2042 1 Million

MGST1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
MHC class I Rabbit Polyclonal Antibody (BF488)
orb1598043 100 µL

MHC class I Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details