Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 1 (Fgf1)

Product Specifications

Product Name Alternative

Acidic fibroblast growth factor; Heparin-binding growth factor 1

Abbreviation

Recombinant Mouse Fgf1 protein

Gene Name

Fgf1

UniProt

P61148

Expression Region

16-155aa

Organism

Mus musculus (Mouse)

Target Sequence

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Tag

N-terminal HSA-tagged and C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1. Can induce angiogenesis

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.50.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

83.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBL2 Blocking peptide
orb1440935 500 µg

MBL2 Blocking peptide

Sign In for Pricing
View Details
Duck Cathepsin Z ELISA Kit
MBS065517 Inquire

Duck Cathepsin Z ELISA Kit

Sign In for Pricing
View Details
WASH2P Protein Vector (Human) (pPB-C-His)
PV046009 500 ng

WASH2P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
(S) -N- (Pyrrolidin-3-yl) pyridine-2-sulfonamide hydrochloride
OR1051527 100 mg

(S) -N- (Pyrrolidin-3-yl) pyridine-2-sulfonamide hydrochloride

Sign In for Pricing
View Details
Human Shc/Slp-76 (SH2-Containing Protein) ELISA Kit
FY-EH2317 96 Well

Human Shc/Slp-76 (SH2-Containing Protein) ELISA Kit

Sign In for Pricing
View Details
Pinobanksin
CSB-DT4896 0.1 g

Pinobanksin

Sign In for Pricing
View Details