Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic polypeptide

Abbreviation

Recombinant Mouse Gip protein, partial

Gene Name

Gip

UniProt

P48756

Expression Region

22-85aa

Organism

Mus musculus (Mouse)

Target Sequence

EKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.47.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK8 Antibody
OACD05439-100UL 100 µL

MAPK8 Antibody

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cystatin A (CSTA)
MBS2006293-01 0.1 mL

Biotin-Linked Antibody to Cystatin A (CSTA)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cystatin A (CSTA)
MBS2006293-02 0.2 mL

Biotin-Linked Antibody to Cystatin A (CSTA)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cystatin A (CSTA)
MBS2006293-03 0.5 mL

Biotin-Linked Antibody to Cystatin A (CSTA)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cystatin A (CSTA)
MBS2006293-04 1 mL

Biotin-Linked Antibody to Cystatin A (CSTA)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cystatin A (CSTA)
MBS2006293-05 5 mL

Biotin-Linked Antibody to Cystatin A (CSTA)

Sign In for Pricing
View Details