Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease 4 (RNASE4)

Product Specifications

Abbreviation

Recombinant Human RNASE4 protein

Gene Name

RNASE4

UniProt

P34096

Expression Region

29-147aa

Organism

Homo sapiens (Human)

Target Sequence

QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Cleaves preferentially after uridine bases. Has antimicrobial activity against uropathogenic E.coli (UPEC) . Probably contributes to urinary tract sterility

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.46.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C26-Dihydro Ceramide
TRC-D448780-25MG 25 mg

C26-Dihydro Ceramide

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS705840 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Ccdc7b Mouse Gene Knockout Kit (CRISPR)
KN500068 1 Kit

Ccdc7b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Human MUC1 (Mucin 1) ELISA Kit
E-UNEL-H0120-01 5x 96 Tests

Uncoated Human MUC1 (Mucin 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human MUC1 (Mucin 1) ELISA Kit
E-UNEL-H0120-02 15x 96 Tests

Uncoated Human MUC1 (Mucin 1) ELISA Kit

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha (CCL20) Goat Polyclonal Antibody
AP31717PU-N 100 µg

Macrophage Inflammatory Protein 3 alpha (CCL20) Goat Polyclonal Antibody

Sign In for Pricing
View Details