Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2), partial

Product Specifications

Product Name Alternative

CD28 homolog; Immunoglobulin and proline-rich receptor 1

Abbreviation

Recombinant Human TMIGD2 protein, partial

Gene Name

TMIGD2

UniProt

Q96BF3

Expression Region

23-150aa

Organism

Homo sapiens (Human)

Target Sequence

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Plays a role in cell-cell interaction, cell migration, and angiogenesis. Through interaction with HHLA2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.43.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), Biotin conjugate, 0.1mg/mL
BNCB2296-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZDHHC1 Human Gene Knockout Kit (CRISPR)
KN403001 1 Kit

ZDHHC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SYK (Ab-323) Antibody
8B0580-AAT 50 µg

SYK (Ab-323) Antibody

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), 0.2mg/mL
BNUB1009-100 1x 100 µL

CD66 (CEA) (C66/1009), 0.2mg/mL

Sign In for Pricing
View Details
Rabphilin 3A (RPH3A) (NM_014954) Human Recombinant Protein
TP305675M 100 µg

Rabphilin 3A (RPH3A) (NM_014954) Human Recombinant Protein

Sign In for Pricing
View Details
CTNND1 (NM_001085461) Human Over-expression Lysate
LY421310 100 µg

CTNND1 (NM_001085461) Human Over-expression Lysate

Sign In for Pricing
View Details