Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial

Product Specifications

Product Name Alternative

P55

Abbreviation

Recombinant Mouse Il2ra protein, partial

Gene Name

Il2ra

UniProt

P01590

Expression Region

22-236aa

Organism

Mus musculus (Mouse)

Target Sequence

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.37.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbtb8a Rat shRNA Plasmid (Locus ID 313049)
TL706460 1 Kit

Zbtb8a Rat shRNA Plasmid (Locus ID 313049)

Sign In for Pricing
View Details
Rap 2C Polyclonal Antibody
UB-GEN-15645 100 µL

Rap 2C Polyclonal Antibody

Sign In for Pricing
View Details
CD-MPR CRISPR/Cas9 KO Plasmid (h)
sc-409471 20 µg

CD-MPR CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
ABLIM1 Polyclonal Antibody, Cy7 Conjugated
bs-11449R-Cy7 100 µL

ABLIM1 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Rat ALPL-Alkaline Phosphatase, Liver/Bone/Kidney- ELISA Kit
E-EL-R1109-01 24 Tests

Rat ALPL-Alkaline Phosphatase, Liver/Bone/Kidney- ELISA Kit

Sign In for Pricing
View Details
Rat ALPL-Alkaline Phosphatase, Liver/Bone/Kidney- ELISA Kit
E-EL-R1109-02 48 Tests

Rat ALPL-Alkaline Phosphatase, Liver/Bone/Kidney- ELISA Kit

Sign In for Pricing
View Details