Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative butyrophilin-like protein 10 pseudogene (BTNL10P), partial

Product Specifications

Abbreviation

Recombinant Human BTNL10P protein, partial

Gene Name

BTNL10P

UniProt

A8MVZ5

Expression Region

27-254aa

Organism

Homo sapiens (Human)

Target Sequence

SIWKADFDVTGPHAPILAMAGGHVELQCQLFPNISAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTTFDNRTYCCRFKDGVKFGEATVQVQVAGLGREPRIQVTDQQDGVRAECTSAGCFPKSWVERRDFRGQARPAVTNLSASATTRLWAVASSLTLWDRAVEGLSCSISSPLLPERRKVAESHLPATFSRSSQFTAWKA

Tag

C-terminal mFc2a-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.34.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Finger Protein 750 (ZNF750) Antibody
abx239738 100 µg

Zinc Finger Protein 750 (ZNF750) Antibody

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)
MBS2151017-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)
MBS2151017-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)
MBS2151017-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)
MBS2151017-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)
MBS2151017-05 5 mL

APC_Cy7-Linked Monoclonal Antibody to Alpha 2-Antiplasmin (a2PI)

Sign In for Pricing
View Details