Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2)

Product Specifications

Product Name Alternative

Chondromodulin II

Abbreviation

Recombinant Mouse Lect2 protein

Gene Name

Lect2

UniProt

O88803

Expression Region

19-151aa

Organism

Mus musculus (Mouse)

Target Sequence

GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Developmental Biology

Relevance

Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.21.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lamp2 Mouse Gene Knockout Kit (CRISPR)
KN309118LP 1 Kit

Lamp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), 0.2mg/mL
BNUB2292-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), 0.2mg/mL

Sign In for Pricing
View Details
DdTTP [2',3'-Dideoxythymidine-5'-triphosphate] *10 mM in ddH2O*
17208-AAT 1 µmole

DdTTP [2',3'-Dideoxythymidine-5'-triphosphate] *10 mM in ddH2O*

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), CF740 conjugate, 0.1mg/mL
BNC742173-500 1x 500 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mesotartaric Acid Monohydrate
TRC-M225773-500MG 500 mg

Mesotartaric Acid Monohydrate

Sign In for Pricing
View Details
PCPTP1 (PTPRR) (NM_130846) Human Recombinant Protein
TP311122M 100 µg

PCPTP1 (PTPRR) (NM_130846) Human Recombinant Protein

Sign In for Pricing
View Details