Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial (NDUFS6)

Product Specifications

Product Name Alternative

Complex I-13kD-A; NADH-ubiquinone oxidoreductase 13 kDa-A subunit

Abbreviation

Recombinant Human NDUFS6 protein

Gene Name

NDUFS6

UniProt

O75380

Expression Region

29-124aa

Organism

Homo sapiens (Human)

Target Sequence

GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal transduction

Relevance

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.20.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-500 1x 500 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details