Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein-2 (KLK2) (Active)

Product Specifications

Product Name Alternative

Kallikrein-2; EC 3.4.21.35; Glandular kallikrein-1; hGK-1; Tissue kallikrein-2

Abbreviation

Recombinant Human KLK2 protein (Active)

Gene Name

KLK2

UniProt

P20151

Expression Region

19-261aa

Organism

Homo sapiens (Human)

Target Sequence

PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human KLK2 at 2 μg/mL can bind Anti-KLK2 recombinant antibody (CSB-RA012453MA1HU) . The EC50 is 0.6741-0.8245 ng/mL. 2Measured by its ability to cleave a flourogenic peptide substrate Pro-Phe-Arg-7-amido-4-methylcoumarin (PFR-AMC) . The specific activity is >350 pmol/min/μg.

Form

Liquid

Buffer

0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0

Molecular Weight

29.6 kDa

References & Citations

Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rak (H-12) Alexa Fluor® 594
sc-166478 AF594 200 µg/mL

Rak (H-12) Alexa Fluor® 594

Sign In for Pricing
View Details
α, β-[UL-13C12]Trehalose
167215 1 mg

α, β-[UL-13C12]Trehalose

Sign In for Pricing
View Details
Trem2, NT (Trem2, Trem2a, Trem2b, Trem2c, Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2) (MaxLight 550)
MBS6358051-01 0.1 mL

Trem2, NT (Trem2, Trem2a, Trem2b, Trem2c, Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2) (MaxLight 550)

Sign In for Pricing
View Details
Trem2, NT (Trem2, Trem2a, Trem2b, Trem2c, Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2) (MaxLight 550)
MBS6358051-02 5x 0.1 mL

Trem2, NT (Trem2, Trem2a, Trem2b, Trem2c, Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2) (MaxLight 550)

Sign In for Pricing
View Details
Guinea pig ANF ELISA Kit
MBS267805-01 48 Well

Guinea pig ANF ELISA Kit

Sign In for Pricing
View Details
Guinea pig ANF ELISA Kit
MBS267805-02 96 Well

Guinea pig ANF ELISA Kit

Sign In for Pricing
View Details