Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Amphiregulin (Areg), partial

Product Specifications

Product Name Alternative

Schwannoma-derived growth factor

Abbreviation

Recombinant Mouse Areg protein, partial

Gene Name

Areg

UniProt

P31955

Expression Region

100-191aa

Organism

Mus musculus (Mouse)

Target Sequence

VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSK

Tag

N-terminal hFc1-tagged and C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.1.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 21 (IL21) ELISA Kit
RD-IL21-Hu-01 96 Tests

Human Interleukin 21 (IL21) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 21 (IL21) ELISA Kit
RD-IL21-Hu-02 48 Tests

Human Interleukin 21 (IL21) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc Protein (aa 99-326)
PKSH033650-01 10 µg

Recombinant Human IgG4-Fc Protein (aa 99-326)

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc Protein (aa 99-326)
PKSH033650-02 50 µg

Recombinant Human IgG4-Fc Protein (aa 99-326)

Sign In for Pricing
View Details
Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
RD-FNDC5-Ra-01 96 Tests

Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
RD-FNDC5-Ra-02 48 Tests

Rat Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details