Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin D (CTSD) (Active)

Product Specifications

Product Name Alternative

Cathepsin D; EC 3.4.23.5 [Cleaved into: Cathepsin D light chain; Cathepsin D heavy chain]

Abbreviation

Recombinant Human CTSD protein (Active)

Gene Name

CTSD

UniProt

P07339

Expression Region

21-412aa

Organism

Homo sapiens (Human)

Target Sequence

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation (PubMed:27333034) . Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2.The specific activity is >2000 pmol/min/μg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.0 kDa

References & Citations

Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Transmembrane Domains

0TM

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophilin A (PPIA) (NM_021130) Human Over-expression Lysate
LC402839 20 µg

Cyclophilin A (PPIA) (NM_021130) Human Over-expression Lysate

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF488A conjugate, 0.1mg/mL
BNC883632-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trisodium UDP-glucuronic Acid
TRC-T886285-10MG 10 mg

Trisodium UDP-glucuronic Acid

Sign In for Pricing
View Details
JAK2 Rabbit Polyclonal Antibody
AP08050PU-S 50 µL

JAK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GmL (NM_002066) Human Over-expression Lysate
LY400757 100 µg

GmL (NM_002066) Human Over-expression Lysate

Sign In for Pricing
View Details
MAX Mouse Monoclonal Antibody [Clone ID: OTI14G1]
CF815026 100 µg

MAX Mouse Monoclonal Antibody [Clone ID: OTI14G1]

Sign In for Pricing
View Details