Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)

Product Specifications

Product Name Alternative

Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326

Abbreviation

Recombinant Human EPCAM protein, partial (Active)

Gene Name

EPCAM

UniProt

P16422

Expression Region

24-265aa

Organism

Homo sapiens (Human)

Target Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/mL can bind Anti-EPCAM recombinant antibody (CSB-RA007717MA2HU) . The EC50 is 1.098-1.401 ng/mL. 2EPCAM Recombinant Monoclonal Antibody (CSB-RA007717MA2HU) captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay (WeSPRTM 200) .

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.8 kDa

References & Citations

The tumour-associated antigen EpCAM upregulates the fatty acid binding protein E-FABP. Muenz M., Zeidler R., Gires O. Cancer Lett. 225:151-157 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Transmembrane Domains

0TM

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THEM4 Polyclonal Antibody
MBS9140632-01 0.02 mL

THEM4 Polyclonal Antibody

Sign In for Pricing
View Details
THEM4 Polyclonal Antibody
MBS9140632-02 0.05 mL

THEM4 Polyclonal Antibody

Sign In for Pricing
View Details
THEM4 Polyclonal Antibody
MBS9140632-03 0.1 mL

THEM4 Polyclonal Antibody

Sign In for Pricing
View Details
THEM4 Polyclonal Antibody
MBS9140632-04 0.2 mL

THEM4 Polyclonal Antibody

Sign In for Pricing
View Details
THEM4 Polyclonal Antibody
MBS9140632-05 5x 0.2 mL

THEM4 Polyclonal Antibody

Sign In for Pricing
View Details
ADORA2A Antibody
MBS854826-01 0.1 mg

ADORA2A Antibody

Sign In for Pricing
View Details