Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial

Product Specifications

Product Name Alternative

ADAMTS21

Abbreviation

Recombinant Human ADAMTS18 protein, partial

Gene Name

ADAMTS18

UniProt

Q8TE60

Expression Region

913-1040aa

Organism

Homo sapiens (Human)

Target Sequence

CSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQ

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.1 kDa

References & Citations

"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUT 1 (Glucose Transporter 1) (MaxLight 490)
G3900-12-ML490 100 µL

GLUT 1 (Glucose Transporter 1) (MaxLight 490)

Sign In for Pricing
View Details
MMP7 (Matrilysin, Matrin, Uterine Matrilysin, Matrix Metalloproteinase-7, MMP 7, MPSL1, MMP7, PUMP 1, Matrix Metalloproteinase 7, Pump 1 Protease, PUMP1, MMP7 HUMAN, MMP-7, Pump-1 Protease, Uterine Metalloproteinase)
385051 100 µg

MMP7 (Matrilysin, Matrin, Uterine Matrilysin, Matrix Metalloproteinase-7, MMP 7, MPSL1, MMP7, PUMP 1, Matrix Metalloproteinase 7, Pump 1 Protease, PUMP1, MMP7 HUMAN, MMP-7, Pump-1 Protease, Uterine Metalloproteinase)

Sign In for Pricing
View Details
Tmem206 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3437405 3x 1.0 µg

Tmem206 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human CHAD Protein Lysate
MBS139377-01 0.02 mg

Human CHAD Protein Lysate

Sign In for Pricing
View Details
Human CHAD Protein Lysate
MBS139377-02 5x 0.02 mg

Human CHAD Protein Lysate

Sign In for Pricing
View Details
N-Boc-D-proline
GM9500-5g 5 g

N-Boc-D-proline

Sign In for Pricing
View Details