Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deleted in azoospermia-like (DAZL), partial

Product Specifications

Product Name Alternative

(DAZ homolog) (DAZ-like autosomal) (Deleted in azoospermia-like 1) (SPGY-like-autosomal)

Abbreviation

Recombinant Human DAZL protein, partial

Gene Name

DAZL

UniProt

Q92904

Expression Region

130-250aa

Organism

Homo sapiens (Human)

Target Sequence

VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR

Tag

N-terminal 10xHis-GST-tagged and C-terminal V5-Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

RNA-binding protein, which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA, specifically recognizing GUU triplets, and thereby regulating the translation of key transcripts.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.2 kDa

References & Citations

"Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins." Moore F.L., Jaruzelska J., Fox M.S., Urano J., Firpo M.T., Turek P.J., Dorfman D.M., Reijo Pera R.A. Proc. Natl. Acad. Sci. U.S.A. 100:538-543 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-100 1x 100 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details