Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD2, Human (HEK293, His)

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TMIGD2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd2-protein-human-hek-293-his.html

Smiles

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Molecular Formula

126259 (Gene_ID) Q96BF3-1 (L23-G150) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpatch1 Mouse siRNA Oligo Duplex (Locus ID 67471)
SR421276 1 Kit

Gpatch1 Mouse siRNA Oligo Duplex (Locus ID 67471)

Sign In for Pricing
View Details
POLR3K (DNA-directed RNA Polymerase III Subunit RPC10, RNA Polymerase III Subunit C10, DNA-directed RNA Polymerase III Subunit K, RNA Polymerase III 12.5kD Subunit, RPC12.5, RNA Polymerase III Subunit C11, HsC11p, RPC11, hRPC11, My010, C11-RNP3, RPC12.5)
MBS6390187-01 0.1 mL

POLR3K (DNA-directed RNA Polymerase III Subunit RPC10, RNA Polymerase III Subunit C10, DNA-directed RNA Polymerase III Subunit K, RNA Polymerase III 12.5kD Subunit, RPC12.5, RNA Polymerase III Subunit C11, HsC11p, RPC11, hRPC11, My010, C11-RNP3, RPC12.5)

Sign In for Pricing
View Details
POLR3K (DNA-directed RNA Polymerase III Subunit RPC10, RNA Polymerase III Subunit C10, DNA-directed RNA Polymerase III Subunit K, RNA Polymerase III 12.5kD Subunit, RPC12.5, RNA Polymerase III Subunit C11, HsC11p, RPC11, hRPC11, My010, C11-RNP3, RPC12.5)
MBS6390187-02 5x 0.1 mL

POLR3K (DNA-directed RNA Polymerase III Subunit RPC10, RNA Polymerase III Subunit C10, DNA-directed RNA Polymerase III Subunit K, RNA Polymerase III 12.5kD Subunit, RPC12.5, RNA Polymerase III Subunit C11, HsC11p, RPC11, hRPC11, My010, C11-RNP3, RPC12.5)

Sign In for Pricing
View Details
Rat Thioredoxin Reductase 2 (TrxR2) ELISA Kit
EIA06481r 1 Kit

Rat Thioredoxin Reductase 2 (TrxR2) ELISA Kit

Sign In for Pricing
View Details
Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (FITC)
126896-FITC 100 µL

Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (FITC)

Sign In for Pricing
View Details
Deoxycytidine triphosphate
M22742-01 1 g

Deoxycytidine triphosphate

Sign In for Pricing
View Details