TMIGD2, Human (HEK293, His)
TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TMIGD2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tmigd2-protein-human-hek-293-his.html
Smiles
LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG
Molecular Formula
126259 (Gene_ID) Q96BF3-1 (L23-G150) (Accession)
Molecular Weight
Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Grhl2 sgRNA CRISPR Lentivector (Rat) (Target 1)
FRS2 Recombinant Antibody, RBITC Conjugated
FRS2 Recombinant Antibody, RBITC Conjugated