Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD2, Human (HEK293, His)

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TMIGD2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd2-protein-human-hek-293-his.html

Smiles

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Molecular Formula

126259 (Gene_ID) Q96BF3-1 (L23-G150) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD160 sgRNA CRISPR Lentivector (Human) (Target 2)
K0405503 1.0 µg DNA

CD160 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-Human ZNF213 Antibody (C193)
HT088023-01 50 µg

Anti-Human ZNF213 Antibody (C193)

Sign In for Pricing
View Details
Anti-Human ZNF213 Antibody (C193)
HT088023-02 100 µg

Anti-Human ZNF213 Antibody (C193)

Sign In for Pricing
View Details
Anti-Human ZNF213 Antibody (C193)
HT088023-03 1 mg

Anti-Human ZNF213 Antibody (C193)

Sign In for Pricing
View Details
Anti-CHRM5 Polyclonal Antibody
HC049014-01 50 µg

Anti-CHRM5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CHRM5 Polyclonal Antibody
HC049014-02 100 µg

Anti-CHRM5 Polyclonal Antibody

Sign In for Pricing
View Details