Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD2, Human (HEK293, His)

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TMIGD2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd2-protein-human-hek-293-his.html

Smiles

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Molecular Formula

126259 (Gene_ID) Q96BF3-1 (L23-G150) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30/TNFRSF8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated
PH50402M2-01 20 µg

CD30/TNFRSF8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated

Sign In for Pricing
View Details
CD30/TNFRSF8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated
PH50402M2-02 100 µg

CD30/TNFRSF8 Protein, Human, Recombinant (His & AVI Tag), Biotinylated

Sign In for Pricing
View Details
3-Sulfobenzaldehyde Sodium Salt
426664-01 1 g

3-Sulfobenzaldehyde Sodium Salt

Sign In for Pricing
View Details
3-Sulfobenzaldehyde Sodium Salt
426664-02 10 g

3-Sulfobenzaldehyde Sodium Salt

Sign In for Pricing
View Details
RNPC3 Overexpression Lysate (Native) - (Dry Ice)
NBL1-15469 0.1 mg

RNPC3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
VEGFR2 (pY1059) Antibody
abx012340 100 µg

VEGFR2 (pY1059) Antibody

Sign In for Pricing
View Details