TMIGD2, Human (HEK293, His)
TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TMIGD2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tmigd2-protein-human-hek-293-his.html
Smiles
LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG
Molecular Formula
126259 (Gene_ID) Q96BF3-1 (L23-G150) (Accession)
Molecular Weight
Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
POLG2 (DNA Polymerase Subunit gamma-2, HP55, POLB, PEOA4, POLGB, MTPOLB, POLG-beta) (MaxLight 405)
POLG2 (DNA Polymerase Subunit gamma-2, HP55, POLB, PEOA4, POLGB, MTPOLB, POLG-beta) (MaxLight 405)
CCDC56 (COA3) Human siRNA Oligo Duplex (Locus ID 28958)
Beaker Rasotherm ISO Low Form, 800 ml 10 pcs. old KK64000-800
50nm Carboxylated (carboxyl-PEG3000-SH) Silver Nanoparticles