Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD2, Human (HEK293, His)

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TMIGD2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd2-protein-human-hek-293-his.html

Smiles

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Molecular Formula

126259 (Gene_ID) Q96BF3-1 (L23-G150) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human C1QC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8421801-01 0.12 mL

Rabbit Anti Human C1QC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human C1QC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8421801-02 0.2 mL

Rabbit Anti Human C1QC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
Rabbit Anti Human C1QC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)
MBS8421801-03 5x 0.2 mL

Rabbit Anti Human C1QC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC)

Sign In for Pricing
View Details
WIBG CRISPR All-in-one AAV vector set (with saCas9)(Human)
50427151 3x 1.0 µg DNA

WIBG CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human IL7R (Interleukin 7 Receptor) ELISA Kit
EKE63180 96 Tests

Human IL7R (Interleukin 7 Receptor) ELISA Kit

Sign In for Pricing
View Details
ATRX Antibody
MBS9505072-01 0.05 mL

ATRX Antibody

Sign In for Pricing
View Details