Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMIGD2, Human (HEK293, His)

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TMIGD2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmigd2-protein-human-hek-293-his.html

Smiles

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Molecular Formula

126259 (Gene_ID) Q96BF3-1 (L23-G150) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia Enterocolitica YE1782 Protein (aa 1-85) (strain 8081)
VAng-Wyb1964-1mgEcoli 1 mg (E. coli)

Recombinant Yersinia Enterocolitica YE1782 Protein (aa 1-85) (strain 8081)

Sign In for Pricing
View Details
ATP6, Human (His)
HY-P704166 1 Each

ATP6, Human (His)

Sign In for Pricing
View Details
Dnm2 3'UTR Luciferase Stable Cell Line
TU203556 1.0 mL

Dnm2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
uLBP1, 26-216aa, Human, His tag, E Coli
MBS204695-01 0.02 mg

uLBP1, 26-216aa, Human, His tag, E Coli

Sign In for Pricing
View Details
uLBP1, 26-216aa, Human, His tag, E Coli
MBS204695-02 0.1 mg

uLBP1, 26-216aa, Human, His tag, E Coli

Sign In for Pricing
View Details
uLBP1, 26-216aa, Human, His tag, E Coli
MBS204695-03 5x 0.02 mg

uLBP1, 26-216aa, Human, His tag, E Coli

Sign In for Pricing
View Details