Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD117/c-kit, Rat (HEK293, His)

CD117, also known as tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR), is a cytokine receptor that is expressed on the surface of hematopoietic stem cells and other cell types. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 is a proto-oncogene associated with tumor development. CD117/c-kit Protein, Rat (HEK293, His) is the recombinant rat-derived CD117/c-kit protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD117/c-kit Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd117-c-kit-protein-rat-hek293-his.html

Purity

98.00

Smiles

QPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTDPAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLVGLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYHRLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVSTSVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGSANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNRGEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTYDRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSIDSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHT

Molecular Formula

64030 (Gene_ID) Q63116 (Q26-T522) (Accession)

Molecular Weight

Approximately 60-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7C Polyclonal Antibody
UB-GEN-6541 100 µL

BCL7C Polyclonal Antibody

Sign In for Pricing
View Details
ORM2 Protein (N-His, Mus musculus (Mouse) )
P506784 100 µg

ORM2 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
Olfr1164 (NM_146641) Mouse Tagged ORF Clone Lentiviral Particle
MR215089L3V 200 µL

Olfr1164 (NM_146641) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Lens Epithelium Derived Growth Factor (LEDGF) Antibody Pair Kit (with Standard)
MBS2103650-01 5x 96 Tests

Mouse Lens Epithelium Derived Growth Factor (LEDGF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Lens Epithelium Derived Growth Factor (LEDGF) Antibody Pair Kit (with Standard)
MBS2103650-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Lens Epithelium Derived Growth Factor (LEDGF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Lens Epithelium Derived Growth Factor (LEDGF) Antibody Pair Kit (with Standard)
MBS2103650-03 10x 96 Tests

Mouse Lens Epithelium Derived Growth Factor (LEDGF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details