Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD117/c-kit, Rat (HEK293, His)

CD117, also known as tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR), is a cytokine receptor that is expressed on the surface of hematopoietic stem cells and other cell types. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 is a proto-oncogene associated with tumor development. CD117/c-kit Protein, Rat (HEK293, His) is the recombinant rat-derived CD117/c-kit protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD117/c-kit Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd117-c-kit-protein-rat-hek293-his.html

Purity

98.00

Smiles

QPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTDPAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLVGLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYHRLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVSTSVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGSANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNRGEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTYDRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSIDSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHT

Molecular Formula

64030 (Gene_ID) Q63116 (Q26-T522) (Accession)

Molecular Weight

Approximately 60-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP1B (Tyr-152), phospho-specific Antibody
MBS474530-01 0.1 mL

PTP1B (Tyr-152), phospho-specific Antibody

Sign In for Pricing
View Details
PTP1B (Tyr-152), phospho-specific Antibody
MBS474530-02 5x 0.1 mL

PTP1B (Tyr-152), phospho-specific Antibody

Sign In for Pricing
View Details
CHTF18 CytoSection
TS403671P5 25 Slides

CHTF18 CytoSection

Sign In for Pricing
View Details
COPZ2 Antibody (C-term) Blocking Peptide
MBS9225546-01 0.5 mg

COPZ2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
COPZ2 Antibody (C-term) Blocking Peptide
MBS9225546-02 5x 0.5 mg

COPZ2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Mouse Monoclonal NRBP1 Antibody (OTI5C3) [DyLight 755]
NBP2-73056IR 0.1 mL

Mouse Monoclonal NRBP1 Antibody (OTI5C3) [DyLight 755]

Sign In for Pricing
View Details