Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD117/c-kit, Rat (HEK293, His)

CD117, also known as tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR), is a cytokine receptor that is expressed on the surface of hematopoietic stem cells and other cell types. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 is a proto-oncogene associated with tumor development. CD117/c-kit Protein, Rat (HEK293, His) is the recombinant rat-derived CD117/c-kit protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD117/c-kit Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd117-c-kit-protein-rat-hek293-his.html

Purity

98.00

Smiles

QPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTDPAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLVGLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYHRLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVSTSVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGSANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNRGEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTYDRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSIDSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHT

Molecular Formula

64030 (Gene_ID) Q63116 (Q26-T522) (Accession)

Molecular Weight

Approximately 60-110 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVPR V2 (AVPR2) (NM_000054) Human Tagged Lenti ORF Clone
RC210914L4 10 µg

AVPR V2 (AVPR2) (NM_000054) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nicastrin (NCSTN, KIAA0253, UNQ1874/PRO4317) (MaxLight 750) discontinued
130366-ML750 100 µL

Nicastrin (NCSTN, KIAA0253, UNQ1874/PRO4317) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GNA11 Antibody, FITC conjugated
A23392-50UG 50 µg

GNA11 Antibody, FITC conjugated

Sign In for Pricing
View Details
PPIL3 (NM_131916) Human Tagged ORF Clone
RC217389 10 µg

PPIL3 (NM_131916) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-CD328/SIGLEC7 Polyclonal Antibody
PAV5755 100 μL

Rabbit Anti-CD328/SIGLEC7 Polyclonal Antibody

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody
CAU32831-01 100 µL

Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody

Sign In for Pricing
View Details