Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAILR4/TNFRSF10D, Human (HEK293, His)

TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (HEK293, His) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TRAILR4/TNFRSF10D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trailr4-tnfrsf10d-protein-human-hek293-his.html

Purity

95.00

Smiles

ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

Molecular Formula

8793 (Gene_ID) Q9UBN6 (A56-H211) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details