Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAILR4/TNFRSF10D, Human (HEK293, His)

TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (HEK293, His) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TRAILR4/TNFRSF10D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trailr4-tnfrsf10d-protein-human-hek293-his.html

Purity

95.00

Smiles

ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

Molecular Formula

8793 (Gene_ID) Q9UBN6 (A56-H211) (Accession)

Molecular Weight

30-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO9B Rabbit Polyclonal Antibody
orb221553-01 50 μL

MYO9B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO9B Rabbit Polyclonal Antibody
orb221553-02 100 µL

MYO9B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO9B Rabbit Polyclonal Antibody
orb221553-03 200 µL

MYO9B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SEC61B Antibody Picoband®, HRP Conjugate
A07334-2-HRP 100 µg/Vial

Anti-SEC61B Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
FKBP51/FKBP5 polyclonal antibody
BS72339-01 50 µL

FKBP51/FKBP5 polyclonal antibody

Sign In for Pricing
View Details
FKBP51/FKBP5 polyclonal antibody
BS72339-02 100 µL

FKBP51/FKBP5 polyclonal antibody

Sign In for Pricing
View Details