Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45A/DDIT-1, Human (His)

GADD45A/DDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDIT-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GADD45A/DDIT-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gadd45a-dddit-1-protein-human-his.html

Smiles

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Molecular Formula

1647 (Gene_ID) P24522 (M1-R165) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POFUT2 Rabbit Polyclonal Antibody
TA380116 100 µL

POFUT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428P-01 50 Tests

PE/Elab Fluor® 594 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428P-02 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
Cry2 Mouse Gene Knockout Kit (CRISPR)
KN503858 1 Kit

Cry2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ABL2 Mouse Monoclonal Antibody [Clone ID: 1H1B11]
AM06165SU-N 100 µL

ABL2 Mouse Monoclonal Antibody [Clone ID: 1H1B11]

Sign In for Pricing
View Details