Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45A/DDIT-1, Human (His)

GADD45A/DDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDIT-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GADD45A/DDIT-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gadd45a-dddit-1-protein-human-his.html

Smiles

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Molecular Formula

1647 (Gene_ID) P24522 (M1-R165) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Osgin1 activation kit by CRISPRa
GA208972 1 Kit

Mouse Osgin1 activation kit by CRISPRa

Sign In for Pricing
View Details
ACADM Recombinant Rabbit Monoclonal Antibody [JE48-09]
ET7109-74 100 µL

ACADM Recombinant Rabbit Monoclonal Antibody [JE48-09]

Sign In for Pricing
View Details
P53RFP Polyclonal Antibody
E-AB-15118-01 20 µL

P53RFP Polyclonal Antibody

Sign In for Pricing
View Details
P53RFP Polyclonal Antibody
E-AB-15118-02 60 µL

P53RFP Polyclonal Antibody

Sign In for Pricing
View Details
P53RFP Polyclonal Antibody
E-AB-15118-03 120 µL

P53RFP Polyclonal Antibody

Sign In for Pricing
View Details
P53RFP Polyclonal Antibody
E-AB-15118-04 200 µL

P53RFP Polyclonal Antibody

Sign In for Pricing
View Details