Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thyroxine (T4) (MaxLight 650) discontinued

Product Specifications

Clonality

Mab

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
MT3 Antibody
CSB-PA789465-01 50 μL

MT3 Antibody

Sign In for Pricing
View Details
MT3 Antibody
CSB-PA789465-02 100 µL

MT3 Antibody

Sign In for Pricing
View Details
STX16 siRNA Oligos set (Human)
45790171 3x 5 nmol

STX16 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Lentiviral human SAMD9L shRNA (UAS) - Lentiviral human SAMD9L shRNA (UAS) (100)
GTR15330321 1 Vial

Lentiviral human SAMD9L shRNA (UAS) - Lentiviral human SAMD9L shRNA (UAS) (100)

Sign In for Pricing
View Details