Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

(FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)

Abbreviation

Recombinant Chicken FGF2 protein

Gene Name

FGF2

UniProt

P48800

Expression Region

13-158aa

Organism

Gallus gallus (Chicken)

Target Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 . Also acts as an integrin ligand which is required for FGF2 signaling . Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration . Functions as a potent mitogen in vitro . Can induce angiogenesis .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.8 kDa

References & Citations

"Expression of alternatively spliced bFGF first coding exons and antisense mRNAs during chicken embryogenesis." Borja A.Z., Zeller R., Meijers C. Dev. Biol. 157:110-118 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMS1 (PYCARD) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H6]
TA800099AM 100 µL

TMS1 (PYCARD) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H6]

Sign In for Pricing
View Details
LRRN1 Antibody (Biotin)
KB-2028-01 50 μL

LRRN1 Antibody (Biotin)

Sign In for Pricing
View Details
LRRN1 Antibody (Biotin)
KB-2028-02 100 µL

LRRN1 Antibody (Biotin)

Sign In for Pricing
View Details
LRRN1 Antibody (Biotin)
KB-2028-03 1 mL

LRRN1 Antibody (Biotin)

Sign In for Pricing
View Details
H3FA (HIST1H3A) Rabbit Monoclonal Antibody
TA422324 100 µL

H3FA (HIST1H3A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Accuris™ Compact Balance, 500 grams, readability 0.01grams, 230V
W3300-500-E 1 Each

Accuris™ Compact Balance, 500 grams, readability 0.01grams, 230V

Sign In for Pricing
View Details