Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-4/CCL18, Human (His)

MIP-4/CCL18 Protein, Human (His) is a CC chemokine ligand that binds to PITPNM3, GPR30 and CCR8 receptors and also acts as a neutral CCR3 antagonist mediating inflammation, autoimmunity and carcinogenesis. MIP-4/CCL18 Protein, Human (His) is a recombinant human MIP-4/CCL18 (A21-A89) protein expressed by E. coli with a his tag at N end[1][2].

Product Specifications

Product Name Alternative

MIP-4/CCL18 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-4-ccl18-protein-human-his.html

Purity

98.0

Smiles

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Molecular Formula

6362 (Gene_ID) P55774 (A21-A89) (Accession)

Molecular Weight

Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]K Hieshima, et al. A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes. J Immunol. 1997 Aug 1;159 (3) :1140-9.|[2]Sabina A Islam, et al. Identification of human CCR8 as a CCL18 receptor. J Exp Med. 2013 Sep 23;210 (10) :1889-98.|[3]Ling Lin, et al. CCL18 from tumor-associated macrophages promotes angiogenesis in breast cancer. Oncotarget. 2015 Oct 27;6 (33) :34758-73.|[4]Xiaoqiang Liu, et al. CCL18 enhances migration, invasion and EMT by binding CCR8 in bladder cancer cells. Mol Med Rep. 2019 Mar;19 (3) :1678-1686.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human N6AMT2 (EEF1AKMT1) (NM_174928) AAV Particle
RC205604A1V 250 µL

Human N6AMT2 (EEF1AKMT1) (NM_174928) AAV Particle

Sign In for Pricing
View Details
APAF1 Antibody HRP Conjugated
C00042H 100 µL

APAF1 Antibody HRP Conjugated

Sign In for Pricing
View Details
Blk sgRNA CRISPR Lentivector set (Rat)
K7182201 3x 1.0 µg

Blk sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
FRMD4B Polyclonal Antibody, HRP Conjugated
bs-8236R-HRP-TR 20 µL

FRMD4B Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human Caspase 3 ELISA Kit
orb562007-01 48 Tests

Human Caspase 3 ELISA Kit

Sign In for Pricing
View Details
Human Caspase 3 ELISA Kit
orb562007-02 96 Tests

Human Caspase 3 ELISA Kit

Sign In for Pricing
View Details