MIF, Mouse (P. pastoris, His)
The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MIF protein, expressed by P.pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MIF Protein, Mouse (P. pastoris, His), Mouse, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mif-protein-mouse-p-pastoris-his.html
Purity
97.00
Smiles
PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Molecular Formula
17319 (Gene_ID) P34884 (P2-A115) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
DCT (Tyrosinase-related Protein 2, TRP-2, TRP2, L-dopachrome Delta-isomerase, L-dopachrome Tautomerase, DT, TYRP2) (MaxLight 490)
DCT (Tyrosinase-related Protein 2, TRP-2, TRP2, L-dopachrome Delta-isomerase, L-dopachrome Tautomerase, DT, TYRP2) (MaxLight 490)
Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)