Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Mouse (P. pastoris, His)

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MIF protein, expressed by P.pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-mouse-p-pastoris-his.html

Purity

97.00

Smiles

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Formula

17319 (Gene_ID) P34884 (P2-A115) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fhl2 3'UTR Lenti-reporter-Luc Vector
20545086 1.0 µg

Fhl2 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit
MBS7236674-01 48 Well

Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit

Ask
View Details
Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit
MBS7236674-02 96 Well

Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit

Ask
View Details
Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit
MBS7236674-03 5x 96 Well

Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit

Ask
View Details
Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit
MBS7236674-04 10x 96 Well

Sheep ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1) ELISA Kit

Ask
View Details
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA347996 100 µg

Caveolin 1 (CAV1) Rabbit Polyclonal Antibody

Ask
View Details