MIF, Mouse (P. pastoris, His)
The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MIF protein, expressed by P.pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MIF Protein, Mouse (P. pastoris, His), Mouse, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mif-protein-mouse-p-pastoris-his.html
Purity
97.00
Smiles
PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Molecular Formula
17319 (Gene_ID) P34884 (P2-A115) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Collagen III (Collagen alpha-1 (III) Chain, Collagen III alpha 1 Chain Precursor, Collagen III alpha 1 Polypeptide, Collagen Type III alpha 1, COL3A1, Ehlers-Danlos Syndrome Type IV Autosomal Dominant, EDS4A, Fetal Collagen, FLJ34534, Type III Collagen) discontinued
BRP16, ID (FAM203A, BRP16, C8orf30A, Protein FAM203A, Brain protein 16) (MaxLight 650)
BRP16, ID (FAM203A, BRP16, C8orf30A, Protein FAM203A, Brain protein 16) (MaxLight 650)
Rabbit anti-Oryza sativa subsp. japonica (Rice) ARP4 Polyclonal Antibody