MIF, Mouse (P. pastoris, His)
The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MIF protein, expressed by P.pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MIF Protein, Mouse (P. pastoris, His), Mouse, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mif-protein-mouse-p-pastoris-his.html
Purity
97.00
Smiles
PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Molecular Formula
17319 (Gene_ID) P34884 (P2-A115) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF488A conjugate, 0.1mg/mL
