EGF, Canine (His)
The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (His) is the recombinant canine-derived EGF protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
EGF Protein, Canine (His), Canine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/egf-protein-canine-his.html
Purity
95.0
Smiles
NGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR
Molecular Formula
403657 (Gene_ID) Q9BEA0 (N973-R1024) (Accession)
Molecular Weight
Approximately 16-22 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Lentiviral mouse Inf2 shRNA (UAS) - Lentiviral mouse Inf2 shRNA (UAS) (100)
