Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-6, Rat (HEK293, His)

IGFBP-6 protein modulates IGFs' activity, extending their half-life and exhibiting dual regulatory capacity.It activates the MAPK pathway, induces cell migration, and interacts with PHB2.These diverse functions emphasize IGFBP-6's multifaceted role in cellular responses related to growth regulation, signaling, and migration.IGFBP-6 Protein, Rat (HEK293, His) is the recombinant rat-derived IGFBP-6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-6 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-6-protein-rat-hek293-his.html

Purity

95

Smiles

ALAGCPGCGPGVQEEDAGSPADGCAETGGCFRREGQPCGVYIPKCAPGLQCQPRENEETPLRALLIGQGRCQRARGPSEETTKESKPHGGASRPRDRDRQKNPRTSAAPIRPSPVQDGEMGPCRRHLDSVLQQLQTEVFRGGANGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSSQCSARSSG

Molecular Formula

25641 (Gene_ID) P35572/NP_037236.1 (A26-G226) (Accession)

Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF19B Protein Vector (Rat) (pPM-C-HA)
40282026 500 ng

RNF19B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NT5DC1 (h) -PR
sc-95375-PR 10 µM - 20 µL

NT5DC1 (h) -PR

Sign In for Pricing
View Details
Heptanoyl chloride
MBS394854-01 1 g

Heptanoyl chloride

Sign In for Pricing
View Details
Heptanoyl chloride
MBS394854-02 5x 1 g

Heptanoyl chloride

Sign In for Pricing
View Details
CALD1 ORF Vector (Human) (pORF)
ORF001822 1.0 µg DNA

CALD1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PSMD5 AAV Vector (Rat) (CMV)
38005106 1 µg

PSMD5 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details