Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kras4B, Human (184a.a, G12C, His)

Kras4B Protein, Human (184a.a, G12C, His) expresses in E. coli with a His tag at the N-terminus. KRAS G12C is an oncogenic driver mutation in multiple cancer types[1].

Product Specifications

Product Name Alternative

Kras4B Protein, Human (184a.a, G12C, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kras-protein-human-g12c-his.html

Purity

98.00

Smiles

TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Formula

3845 (Gene_ID) AAH13572.1 (T2-C185, G12C) (Accession)

Molecular Weight

Approximately 23-26.0 kDa, observed by reducing SDS-PAGE.

References & Citations

[1]Naiara Santana-Codina, et al. Defining and Targeting Adaptations to Oncogenic KRAS G12C Inhibition Using Quantitative Temporal Proteomics. Cell Rep. 2020 Mar 31;30 (13) :4584-4599.e4.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNK1 (MKNK1) (1-466) mouse monoclonal antibody, clone 2H8, Purified
AM31082PU-N 50 µg

MNK1 (MKNK1) (1-466) mouse monoclonal antibody, clone 2H8, Purified

Sign In for Pricing
View Details
Recombinant Rat SSR4 Protein, His (Fc)-Avi-tagged
SSR4-5416R 50 µg

Recombinant Rat SSR4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Bovine Transfer Factor (TF) ELISA Kit
MBS9354558-01 48 Well

Bovine Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Bovine Transfer Factor (TF) ELISA Kit
MBS9354558-02 96 Well

Bovine Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Bovine Transfer Factor (TF) ELISA Kit
MBS9354558-03 5x 96 Well

Bovine Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Bovine Transfer Factor (TF) ELISA Kit
MBS9354558-04 10x 96 Well

Bovine Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details