Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active)

Product Specifications

Product Name Alternative

CD215; IL15RA; CD215 antigen; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin 15 receptor; alpha; interleukin-15 receptor subunit alpha; MGC104179

Abbreviation

Recombinant Human IL15RA protein, partial (Active)

Gene Name

IL15RA

UniProt

Q13261-3

Expression Region

31-172aa

Organism

Homo sapiens (Human)

Target Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Tag

C-terminal Fc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Interleukin 15 Receptor alpha (IL-15Rα) is a transmembrane glycoprotein that plays a pleiotropic role in immune development and function, including the positive maintenance of lymphocyte homeostasis. IL-15Rα chain can bind soluble IL-15 and “transpresent” cytokine to the cells, allowing them to respond to IL-15. Soluble IL-15Rα can function as a specific high-affinity IL-15 antagonist. The soluble IL-15/IL-15Rα complexes exhibit a strong agonistic activity which is mediated through membrane-bound IL-15 receptor β and γ heterodimers and enables signaling to cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is 0.35-3.5 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Ethylenediamine Iodoacetamide
#90059 1x 25 mg

Biotin Ethylenediamine Iodoacetamide

Sign In for Pricing
View Details
3-Hydroxyquinoline-5-carboxylic Acid
TRC-H502585-5MG 5 mg

3-Hydroxyquinoline-5-carboxylic Acid

Sign In for Pricing
View Details
UPB1 Antibody
KC-14715-01 50 μL

UPB1 Antibody

Sign In for Pricing
View Details
UPB1 Antibody
KC-14715-02 100 µL

UPB1 Antibody

Sign In for Pricing
View Details
UPB1 Antibody
KC-14715-03 1 mL

UPB1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS639388 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details