Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-7, Human (HEK293, Fc)

IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7 Protein, Human (HEK293, Fc) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IGFBP-7 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-7-protein-human-hek293-fc.html

Purity

97.00

Smiles

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Molecular Formula

3490 (Gene_ID) Q16270-1 (S27-L282) (Accession)

Molecular Weight

Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MID2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-11029R-BF405 100 µL

MID2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Human GBE1 qPCR Primer Pair
QH14793S 200 Tests

Human GBE1 qPCR Primer Pair

Sign In for Pricing
View Details
MAX (Protein Max, Class D Basic Helix-loop-helix Protein 4, bHLHd4, Myc-associated Factor X, BHLHD4) (MaxLight 405) discontinued
129458-ML405 100 µL

MAX (Protein Max, Class D Basic Helix-loop-helix Protein 4, bHLHd4, Myc-associated Factor X, BHLHD4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Guinea pig Aquaporin 5 ELISA Kit
MBS729165-01 48 Well

Guinea pig Aquaporin 5 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aquaporin 5 ELISA Kit
MBS729165-02 96 Well

Guinea pig Aquaporin 5 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aquaporin 5 ELISA Kit
MBS729165-03 5x 96 Well

Guinea pig Aquaporin 5 ELISA Kit

Sign In for Pricing
View Details