Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta constant 1 (TRBC1), partial, Biotinylated

Product Specifications

Abbreviation

Recombinant Human TRBC1 protein, partial, Biotinylated

Gene Name

TRBC1

UniProt

P01850

Expression Region

1-129aa

Organism

Homo sapiens (Human)

Target Sequence

DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Pioneer transcription factor, which controls hematopoietic cell fate by decompacting stem cell heterochromatin and allowing other transcription factors to enter otherwise inaccessible genomic sites. Once in open chromatin, can directly control gene expression by binding genetic regulatory elements and can also more broadly influence transcription by recruiting transcription factors, such as interferon regulatory factors (IRFs), to otherwise inaccessible genomic regions. Transcriptionally activates genes important for myeloid and lymphoid lineages, such as CSF1R. Transcriptional activation from certain promoters, possibly containing low affinity binding sites, is achieved cooperatively with other transcription factors. FCER1A transactivation is achieved in cooperation with GATA1. May be particularly important for the pro- to pre-B cell transition. Binds (via the ETS domain) onto the purine-rich DNA core sequence 5'-GAGGAA-3', also known as the PU-box. In vitro can bind RNA and interfere with pre-mRNA splicing.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

62.4 kDa

References & Citations

"PU.1 is required for myeloid-derived but not lymphoid-derived dendritic cells." Guerriero A., Langmuir P.B., Spain L.M., Scott E.W. Blood 95:879-885 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK14 (CPTC-MAPK14-1), CF640R conjugate, 0.1mg/mL
BNC402228-500 1x 500 µL

MAPK14 (CPTC-MAPK14-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tbrg4 Mouse Gene Knockout Kit (CRISPR)
KN517282 1 Kit

Tbrg4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MFGE8 (NM_005928) Human Over-expression Lysate
LY401796 100 µg

MFGE8 (NM_005928) Human Over-expression Lysate

Sign In for Pricing
View Details
Pdzph1 Mouse Gene Knockout Kit (CRISPR)
KN500277 1 Kit

Pdzph1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) Dx
DxTM67200 500 Reactions

COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) Dx

Sign In for Pricing
View Details
2-Azidoethanamine Hydrochloride
TRC-A848563-10MG 10 mg

2-Azidoethanamine Hydrochloride

Sign In for Pricing
View Details