Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BP1 Antibody (OTI8A1) [DyLight 755]
NBP2-70581IR 0.1 mL

Mouse Monoclonal BP1 Antibody (OTI8A1) [DyLight 755]

Sign In for Pricing
View Details
Boric Acid Extra Pure
102940 50 50 Kg

Boric Acid Extra Pure

Sign In for Pricing
View Details
C7orf23 (TMEM243) Human qPCR Template Standard (NM_024315)
HK201529 1 Kit

C7orf23 (TMEM243) Human qPCR Template Standard (NM_024315)

Sign In for Pricing
View Details
RHOBTB3 Antibody
A33214-100UL 100 µL

RHOBTB3 Antibody

Sign In for Pricing
View Details
BMP-8B Polyclonal Antibody
BT-AP00935-01 20 µL

BMP-8B Polyclonal Antibody

Sign In for Pricing
View Details
BMP-8B Polyclonal Antibody
BT-AP00935-02 50 µL

BMP-8B Polyclonal Antibody

Sign In for Pricing
View Details