Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNG2 Rabbit pAb
A6537 100 µL

CACNG2 Rabbit pAb

Sign In for Pricing
View Details
SSB (Lupus La Protein, La Autoantigen, La Ribonucleoprotein, Sjoegren Syndrome Type B Antigen, SS-B) (AP) discontinued
133853-AP 100 µL

SSB (Lupus La Protein, La Autoantigen, La Ribonucleoprotein, Sjoegren Syndrome Type B Antigen, SS-B) (AP) discontinued

Sign In for Pricing
View Details
Human RAB4B shRNA Plasmid
abx959997-01 150 µg

Human RAB4B shRNA Plasmid

Sign In for Pricing
View Details
Human RAB4B shRNA Plasmid
abx959997-02 300 µg

Human RAB4B shRNA Plasmid

Sign In for Pricing
View Details
LTB4-R1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62491R-BF405 100 µL

LTB4-R1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Zfp318 AAV siRNA Pooled Vector
50915164 1.0 µg

Zfp318 AAV siRNA Pooled Vector

Sign In for Pricing
View Details