Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBQLN3 3'UTR Luciferase Stable Cell Line
TU027722 1.0 mL

UBQLN3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) VHL Polyclonal Antibody
MBS9014330 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) VHL Polyclonal Antibody

Sign In for Pricing
View Details
Human AKAP7 (NM_016377) AAV Particle
RC219968A1V 250 µL

Human AKAP7 (NM_016377) AAV Particle

Sign In for Pricing
View Details
NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP) (MaxLight 550)
MBS6212696-01 0.1 mL

NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP) (MaxLight 550)

Sign In for Pricing
View Details
NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP) (MaxLight 550)
MBS6212696-02 5x 0.1 mL

NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP) (MaxLight 550)

Sign In for Pricing
View Details
Hepatitis C Virus NS5a (HCV) (Biotin) discontinued
H1920-28-Biotin 100 µL

Hepatitis C Virus NS5a (HCV) (Biotin) discontinued

Sign In for Pricing
View Details