Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pi4k2b (NM_025951) Mouse Untagged Clone
MC216317 10 µg

Pi4k2b (NM_025951) Mouse Untagged Clone

Sign In for Pricing
View Details
Human ST8SIA3 knockdown cell line
ABC-KD14751 1 Vial

Human ST8SIA3 knockdown cell line

Sign In for Pricing
View Details
Interferon alpha Receptor 1, phosphorylated (Ser535/Ser539)
I7661-76T4 100 µL

Interferon alpha Receptor 1, phosphorylated (Ser535/Ser539)

Sign In for Pricing
View Details
Rabbit Monoclonal PRMT7 Antibody
NBP3-33258-20ul 20 µL

Rabbit Monoclonal PRMT7 Antibody

Sign In for Pricing
View Details
TA2R3 Human Recombinant Protein, Synthetic Nanodisc
TP721842 10 µg

TA2R3 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Fam132a 3'UTR GFP Stable Cell Line
TU254272 1.0 mL

Fam132a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details