Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC13D sgRNA CRISPR Lentivector (Human) (Target 3)
K2588904 1.0 µg DNA

UNC13D sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse anti-FluA nucleoprotein mAb (5A2)
A09F11-5A2 1 Each

Mouse anti-FluA nucleoprotein mAb (5A2)

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF433 Antibody
NBP2-58010 100 µL

Rabbit Polyclonal ZNF433 Antibody

Sign In for Pricing
View Details
TERT-BUTYL 10-AMINODECANOATE
JH914769 1 Each

TERT-BUTYL 10-AMINODECANOATE

Sign In for Pricing
View Details
Rabbit Polyclonal TMUB1 Antibody [DyLight 594]
NBP3-18424DL594 0.1 mL

Rabbit Polyclonal TMUB1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana ZF-HD homeobox protein At5g65410 (At5g65410)
MBS1447993-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana ZF-HD homeobox protein At5g65410 (At5g65410)

Sign In for Pricing
View Details