CD79B, Human (Biotinylated, HEK293, His-Avi)
CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html
Purity
98.0
Smiles
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Molecular Formula
974 (Gene_ID) P40259 (A29-D159) (Accession)
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PTPN11, CT (Tyrosine-protein Phosphatase Non-receptor Type 11, Protein-tyrosine Phosphatase 2C, PTP-2C, Protein-tyrosine Phosphatase 1D, PTP-1D, SH-PTP3, SH-PTP2, SHP-2, Shp2, SHPTP2, PTP2C) (PE)
PTPN11, CT (Tyrosine-protein Phosphatase Non-receptor Type 11, Protein-tyrosine Phosphatase 2C, PTP-2C, Protein-tyrosine Phosphatase 1D, PTP-1D, SH-PTP3, SH-PTP2, SHP-2, Shp2, SHPTP2, PTP2C) (PE)
Recombinant Human PAH/ PH Protein, His-SUMO, E.coli-10ug
