Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein argonaute-2 (EIF2C2) ELISA Kit
RK10190 96 Tests

Human Protein argonaute-2 (EIF2C2) ELISA Kit

Sign In for Pricing
View Details
SNCG (Gamma-synuclein, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, BCSG1, PERSYN, PRSN) (AP) discontinued
133619-AP 100 µL

SNCG (Gamma-synuclein, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, BCSG1, PERSYN, PRSN) (AP) discontinued

Sign In for Pricing
View Details
C9orf96 (Chromosome 9 Open Reading Frame 96, MGC43306, RP11-244N20.8) (HRP)
244109-HRP 100 µL

C9orf96 (Chromosome 9 Open Reading Frame 96, MGC43306, RP11-244N20.8) (HRP)

Sign In for Pricing
View Details
FBXO21 Mouse Monoclonal Antibody [Clone ID: OTI1E1]
TA503940S 30 µL

FBXO21 Mouse Monoclonal Antibody [Clone ID: OTI1E1]

Sign In for Pricing
View Details
Mouse KRTAP3-1 shRNA Plasmid
abx976946-01 150 µg

Mouse KRTAP3-1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse KRTAP3-1 shRNA Plasmid
abx976946-02 300 µg

Mouse KRTAP3-1 shRNA Plasmid

Sign In for Pricing
View Details