Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDGA1 Protein Vector (Human) (pPM-C-His)
PV093621 500 ng

MDGA1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
7-Bromo-4-fluorobenzofuran
439485-01 25 mg

7-Bromo-4-fluorobenzofuran

Sign In for Pricing
View Details
7-Bromo-4-fluorobenzofuran
439485-02 50 mg

7-Bromo-4-fluorobenzofuran

Sign In for Pricing
View Details
Goat B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit
MBS9397605 Inquire

Goat B-Domain Deleted Factor VIII Antigen (BDF8Ag) ELISA Kit

Sign In for Pricing
View Details
PGAM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B12]
TA503440BM 100 µL

PGAM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B12]

Sign In for Pricing
View Details
Rhodopsin, Red Green (OPSD, Opsin 2, Opsin 2 Rod Pigment, Opsin-2, OPN2, Retinitis Pigmentosa 4, Retinitis Pigmentosa 4 Autosomal Dominant, RP4) (MaxLight 650)
R1998-18-ML650 100 µL

Rhodopsin, Red Green (OPSD, Opsin 2, Opsin 2 Rod Pigment, Opsin-2, OPN2, Retinitis Pigmentosa 4, Retinitis Pigmentosa 4 Autosomal Dominant, RP4) (MaxLight 650)

Sign In for Pricing
View Details