Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBTFL1 Peptide
MBS3235149-01 0.1 mg

UBTFL1 Peptide

Sign In for Pricing
View Details
UBTFL1 Peptide
MBS3235149-02 5x 0.1 mg

UBTFL1 Peptide

Sign In for Pricing
View Details
Mouse Ciliary Neurotrophic Factor (CNTF) ELISA Kit
RDR-CNTF-Mu-48Tests 48 Tests

Mouse Ciliary Neurotrophic Factor (CNTF) ELISA Kit

Sign In for Pricing
View Details
Screw Caps with O-ring, Natural
SC-C 500 per Unit, 8 Units per Case

Screw Caps with O-ring, Natural

Sign In for Pricing
View Details
BMP2K (Putative Uncharacterized Protein BMP2K EMBL AAY40926.1, BMP2 Inducible Kinase)
476282 100 µL

BMP2K (Putative Uncharacterized Protein BMP2K EMBL AAY40926.1, BMP2 Inducible Kinase)

Sign In for Pricing
View Details
RAB6A Protein Vector (Rat) (pPM-C-HA)
38357026 500 ng

RAB6A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details