Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O6:K15:H31 Protein CysZ (cysZ)
MBS7013550-01 0.02 mg

Recombinant Escherichia coli O6:K15:H31 Protein CysZ (cysZ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Protein CysZ (cysZ)
MBS7013550-02 0.1 mg

Recombinant Escherichia coli O6:K15:H31 Protein CysZ (cysZ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Protein CysZ (cysZ)
MBS7013550-03 5x 0.1 mg

Recombinant Escherichia coli O6:K15:H31 Protein CysZ (cysZ)

Sign In for Pricing
View Details
SMURF 2 (SMURF2) (NM_022739) Human Over-expression Lysate
LH17603V 100 µg

SMURF 2 (SMURF2) (NM_022739) Human Over-expression Lysate

Sign In for Pricing
View Details
YY1 (H-10) PE
sc-7341 PE 200 µg/mL

YY1 (H-10) PE

Sign In for Pricing
View Details
NKX2-1 (BCH, BHC, NK-2, TEBP, TTF1, Thyroid-Specific Transcription Factor, NKX2A, TITF1, TTF-1, NKX2.1) (AP)
MBS6429158-01 0.1 mL

NKX2-1 (BCH, BHC, NK-2, TEBP, TTF1, Thyroid-Specific Transcription Factor, NKX2A, TITF1, TTF-1, NKX2.1) (AP)

Sign In for Pricing
View Details