Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Duttonii rpmF Protein (aa 1-60)
VAng-Lsx1958-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Duttonii rpmF Protein (aa 1-60)

Sign In for Pricing
View Details
[KO Validated] AKT2 Rabbit pAb
E45M08802N-100 100 µL

[KO Validated] AKT2 Rabbit pAb

Sign In for Pricing
View Details
TD-6450
HY-117620 1 Each

TD-6450

Sign In for Pricing
View Details
BCL2L2-PABPN1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV719638 1.0 µg DNA

BCL2L2-PABPN1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Gp91-phox Double Nickase Plasmid (h2)
sc-400222-NIC-2 20 µg

Gp91-phox Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Mouse Monoclonal p63/TP73L Antibody (TP63/2427) [DyLight 350]
NBP3-08735UV 100 µL

Mouse Monoclonal p63/TP73L Antibody (TP63/2427) [DyLight 350]

Sign In for Pricing
View Details