Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM17 Knockout HEK293T Polyclonal Cells
ARG25603 1 Million

ADAM17 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Nucleolin (Phospho Thr84) (1I11) Rabbit Monoclonal Antibody
E28G2343 100 µL

Nucleolin (Phospho Thr84) (1I11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human MS4A4A VersaClone cDNA
RDC0233 10 µg

Human MS4A4A VersaClone cDNA

Sign In for Pricing
View Details
Cytidine
C16611 10 mM / 1 mL

Cytidine

Sign In for Pricing
View Details
Abt1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7272502 1.0 µg DNA

Abt1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PU.1/Spi-1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-10869 0.1 mg

PU.1/Spi-1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details