Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Growth Hormone (1-43)
E-PP-1347-01 1 mg

Human Growth Hormone (1-43)

Sign In for Pricing
View Details
Human Growth Hormone (1-43)
E-PP-1347-02 10 mg

Human Growth Hormone (1-43)

Sign In for Pricing
View Details
Human Growth Hormone (1-43)
E-PP-1347-03 5 mg

Human Growth Hormone (1-43)

Sign In for Pricing
View Details
Recombinant Human Sperm flagellar protein 1
32-10014-50 50 µg

Recombinant Human Sperm flagellar protein 1

Sign In for Pricing
View Details
Human hsa-miR-3663-3p miRNA Agomir
abx881135-01 5 nmol

Human hsa-miR-3663-3p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-3663-3p miRNA Agomir
abx881135-02 10 nmol

Human hsa-miR-3663-3p miRNA Agomir

Sign In for Pricing
View Details