Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat P21 Protein (P21) ELISA Kit
EIA07152Go 1 Kit

Goat P21 Protein (P21) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Pancreatic Amylase Beta Antibody (OTI4B5) [Biotin]
NBP2-73240B 0.1 mL

Mouse Monoclonal Pancreatic Amylase Beta Antibody (OTI4B5) [Biotin]

Sign In for Pricing
View Details
Slc10a1 (NM_001177561) Mouse Tagged Lenti ORF Clone
MR205550L4 10 µg

Slc10a1 (NM_001177561) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MYOG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1380808 1.0 µg DNA

MYOG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Blotto/Antifoam in TBS
40220036-2 500 mL

Blotto/Antifoam in TBS

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) OFP3 Polyclonal Antibody
MBS9017304 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) OFP3 Polyclonal Antibody

Sign In for Pricing
View Details