Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creb3l4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6263806 1.0 µg DNA

Creb3l4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human thymus activation regulated chemokine, TARC ELISA Kit
NB-E10052-01 96 Well

Human thymus activation regulated chemokine, TARC ELISA Kit

Sign In for Pricing
View Details
Human thymus activation regulated chemokine, TARC ELISA Kit
NB-E10052-02 96 Well

Human thymus activation regulated chemokine, TARC ELISA Kit

Sign In for Pricing
View Details
E-Selectin (SELE) Antibody
abx404514-01 100 µL

E-Selectin (SELE) Antibody

Sign In for Pricing
View Details
E-Selectin (SELE) Antibody
abx404514-02 200 µL

E-Selectin (SELE) Antibody

Sign In for Pricing
View Details
E-Selectin (SELE) Antibody
abx404514-03 1 mL

E-Selectin (SELE) Antibody

Sign In for Pricing
View Details