Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHA6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1604005 3x 1.0 µg

PCDHA6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ACOT8 Antibody, HRP conjugated
A11744-50UL 50 μL

ACOT8 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rno-miR-665 agomir
HY-R04552A-01 5 nmol

Rno-miR-665 agomir

Sign In for Pricing
View Details
Rno-miR-665 agomir
HY-R04552A-02 20 nmol

Rno-miR-665 agomir

Sign In for Pricing
View Details
GC Column, H1-35MS, 30m*0.53mm*1.0μm, 1pc/pk
14011251 1 PC

GC Column, H1-35MS, 30m*0.53mm*1.0μm, 1pc/pk

Sign In for Pricing
View Details
Whirlin (D-5) : m-IgGκ BP-HRP Bundle
sc-535068 1 Kit

Whirlin (D-5) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details