Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AS-605240 (Standard)
HY-10109R 1 Each

AS-605240 (Standard)

Sign In for Pricing
View Details
RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)
MBS6184838-01 0.1 mL

RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)

Sign In for Pricing
View Details
RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)
MBS6184838-02 5x 0.1 mL

RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (PE)

Sign In for Pricing
View Details
NEK11L, CT (NIMA-related Kinase 11L, Never in Mitosis A-related Kinase 11, NimA-related Protein Kinase 11, NEK11, FLJ23495, Serine/threonine Protein Kinase Nek11) (AP) discontinued
N0800-13C-AP 200 µL

NEK11L, CT (NIMA-related Kinase 11L, Never in Mitosis A-related Kinase 11, NimA-related Protein Kinase 11, NEK11, FLJ23495, Serine/threonine Protein Kinase Nek11) (AP) discontinued

Sign In for Pricing
View Details
Bovine Galectin 9 ELISA Kit
OM623982 96 Strip Well

Bovine Galectin 9 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human TBC1D5 pAb
PA10680-01 50 μL

Rabbit Anti-Human TBC1D5 pAb

Sign In for Pricing
View Details