Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVEN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0160108 1.0 µg DNA

AVEN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Ddx19a sgRNA CRISPR Lentivector set (Mouse)
K3821301 3x 1.0 µg

Ddx19a sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
APBB3 Protein (N-His, Human)
P500550 100 µg

APBB3 Protein (N-His, Human)

Sign In for Pricing
View Details
E. coli Shiga toxin 2 RT PCR kit
RTq-VH108-150D 150T

E. coli Shiga toxin 2 RT PCR kit

Sign In for Pricing
View Details
Troponin I Type 1, Slow Skeletal (TNNI1) Recombinant, Human
157170-01 10 µg

Troponin I Type 1, Slow Skeletal (TNNI1) Recombinant, Human

Sign In for Pricing
View Details
Troponin I Type 1, Slow Skeletal (TNNI1) Recombinant, Human
157170-02 50 µg

Troponin I Type 1, Slow Skeletal (TNNI1) Recombinant, Human

Sign In for Pricing
View Details