Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC7A, CT (TTC7A, KIAA1140, TTC7, Tetratricopeptide repeat protein 7A) (Azide free) (HRP) discontinued
043426-HRP 200 µL

TTC7A, CT (TTC7A, KIAA1140, TTC7, Tetratricopeptide repeat protein 7A) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae PRDM16 Protein (aa 19-471) [His/SUMO]
VAng-Wyb5344-50g 50 µg

Recombinant Saccharomyces Cerevisiae PRDM16 Protein (aa 19-471) [His/SUMO]

Sign In for Pricing
View Details
PRMT7 (Protein Arginine N-methyltransferase 7, FLJ10640, KIAA1933)
P9004-35 100 µg

PRMT7 (Protein Arginine N-methyltransferase 7, FLJ10640, KIAA1933)

Sign In for Pricing
View Details
(E/Z) -Endoxifen
M17807-01 1 g

(E/Z) -Endoxifen

Sign In for Pricing
View Details
(E/Z) -Endoxifen
M17807-02 200 mg

(E/Z) -Endoxifen

Sign In for Pricing
View Details
(E/Z) -Endoxifen
M17807-03 10 mg

(E/Z) -Endoxifen

Sign In for Pricing
View Details