Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHNAK (NM_024060) Human Recombinant Protein
TP315337M 100 µg

AHNAK (NM_024060) Human Recombinant Protein

Sign In for Pricing
View Details
LC3 Antibody (APG8C) (T48) Blocking peptide
MBS9223071-01 0.5 mg

LC3 Antibody (APG8C) (T48) Blocking peptide

Sign In for Pricing
View Details
LC3 Antibody (APG8C) (T48) Blocking peptide
MBS9223071-02 5x 0.5 mg

LC3 Antibody (APG8C) (T48) Blocking peptide

Sign In for Pricing
View Details
β-glucosidase (β-GC) Assay Kit
E47S045 100 Tests - 48 Samples

β-glucosidase (β-GC) Assay Kit

Sign In for Pricing
View Details
MOCS1, CT (MOCS1, Molybdenum cofactor biosynthesis protein 1, Cell migration-inducing gene 11 protein, Molybdenum cofactor synthesis-step 1 protein A-B, Molybdenum cofactor biosynthesis protein A, Molybdenum cofactor biosynthesis protein C) (MaxLight 550)
MBS6321599-01 0.1 mL

MOCS1, CT (MOCS1, Molybdenum cofactor biosynthesis protein 1, Cell migration-inducing gene 11 protein, Molybdenum cofactor synthesis-step 1 protein A-B, Molybdenum cofactor biosynthesis protein A, Molybdenum cofactor biosynthesis protein C) (MaxLight 550)

Sign In for Pricing
View Details
MOCS1, CT (MOCS1, Molybdenum cofactor biosynthesis protein 1, Cell migration-inducing gene 11 protein, Molybdenum cofactor synthesis-step 1 protein A-B, Molybdenum cofactor biosynthesis protein A, Molybdenum cofactor biosynthesis protein C) (MaxLight 550)
MBS6321599-02 5x 0.1 mL

MOCS1, CT (MOCS1, Molybdenum cofactor biosynthesis protein 1, Cell migration-inducing gene 11 protein, Molybdenum cofactor synthesis-step 1 protein A-B, Molybdenum cofactor biosynthesis protein A, Molybdenum cofactor biosynthesis protein C) (MaxLight 550)

Sign In for Pricing
View Details