Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Human (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his-avi.html

Purity

98.0

Smiles

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

974 (Gene_ID) P40259 (A29-D159) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc35b1 shRNA (UAS) - Lentiviral mouseSlc35b1 shRNA (UAS, GFP) (25)
GTR15126380 1 Vial

Lentiviral mouse Slc35b1 shRNA (UAS) - Lentiviral mouseSlc35b1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
5033411D12Rik 3'UTR Luciferase Stable Cell Line
TU100878 1.0 mL

5033411D12Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Polysciences Bead Coupling Buffer, pH 7.4
24974-1000 1000 mL

Polysciences Bead Coupling Buffer, pH 7.4

Sign In for Pricing
View Details
Mouse OGA (O-GlcNAcase) ELISA Kit
EK240184 96 Well

Mouse OGA (O-GlcNAcase) ELISA Kit

Sign In for Pricing
View Details
SMARCA2 Protein Vector (Mouse) (pPM-C-HA)
PV231772 500 ng

SMARCA2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-gamma Sarcoglycan  (3C5)
YF-MA15396 100 ug

Anti-gamma Sarcoglycan (3C5)

Sign In for Pricing
View Details