Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgE, Human (HEK293, His)

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (HEK293, His) is the recombinant human-derived IgE protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IgE Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ige-ighe-protein-human-hek293-his.html

Purity

96.96

Smiles

CADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK

Molecular Formula

/ (Gene_ID) AAB59395 (C208-K427) (Accession)

Molecular Weight

Approximately 26-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-500 1x 500 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL
BNC402895-500 1x 500 µL

C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF660R conjugate, 0.1mg/mL
BNC610874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details