Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgE, Human (HEK293, His)

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (HEK293, His) is the recombinant human-derived IgE protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IgE Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ige-ighe-protein-human-hek293-his.html

Purity

96.96

Smiles

CADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK

Molecular Formula

/ (Gene_ID) AAB59395 (C208-K427) (Accession)

Molecular Weight

Approximately 26-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarecycline free base
MBS5778338 Inquire

Sarecycline free base

Sign In for Pricing
View Details
BAHD1 shRNA (h) Lentiviral Particles
sc-90189-V 200 µL

BAHD1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Dnajc6 (NM_001164585) Mouse Untagged Clone
MC222471 10 µg

Dnajc6 (NM_001164585) Mouse Untagged Clone

Sign In for Pricing
View Details
PE anti-human CD15
E16FHP0151-025 25 Tests

PE anti-human CD15

Sign In for Pricing
View Details
2610301G19Rik Protein Vector (Mouse) (pPM-C-HA)
PV148396 500 ng

2610301G19Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PTTG2, ID (PTTG2, Securin-2, Pituitary tumor-transforming gene 2 protein) (MaxLight 490)
MBS6339135-01 0.1 mL

PTTG2, ID (PTTG2, Securin-2, Pituitary tumor-transforming gene 2 protein) (MaxLight 490)

Sign In for Pricing
View Details