Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active)

Product Specifications

Product Name Alternative

Brain-Derived Neurotrophic Factor; BDNF; Abrineurin

Abbreviation

Recombinant Human BDNF protein (Active)

Gene Name

BDNF

UniProt

P23560

Expression Region

129-247aa

Organism

Homo sapiens (Human)

Target Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Brain-Derived Neurotrophic Factor (BDNF) is a member of the neurotrophin family. Along with other structurally related neurotrophic factors NGF, NT-3 and NT-4, BDNF binds with high affinity to the TrkB kinase receptor. It also binds with the LNGFR (for low-affinity nerve growth factor receptor, also known as p75) . BDNF promotes the survival, growth and differentiation of neurons. It serves as a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TrkB (C-6His) at 5 μg/mL can bind Human BDNF, Biotinylated by NHS-biotin prior to testing, the EC50 of Human BDNF is ≤20 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sinensetin 10mg
A22450-10 10 mg

Sinensetin 10mg

Sign In for Pricing
View Details
P120 Catenin Antibody (pTyr96) / CTNND1 / Catenin delta 1
V7701-20UG 20 µg

P120 Catenin Antibody (pTyr96) / CTNND1 / Catenin delta 1

Sign In for Pricing
View Details
Pig Eosinophil cationic protein ECP ELISA Kit
GTR10477679-01 48 Well

Pig Eosinophil cationic protein ECP ELISA Kit

Sign In for Pricing
View Details
Pig Eosinophil cationic protein ECP ELISA Kit
GTR10477679-02 96 Well

Pig Eosinophil cationic protein ECP ELISA Kit

Sign In for Pricing
View Details
Pig Eosinophil cationic protein ECP ELISA Kit
GTR10477679-03 192 Well

Pig Eosinophil cationic protein ECP ELISA Kit

Sign In for Pricing
View Details
Anti-Caspase-1 CASP1 Rabbit Monoclonal Antibody, Carrier-free
M00048-carrier-free 100 µL

Anti-Caspase-1 CASP1 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details