SDC4, Mouse (HEK293, His)
SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
SDC4 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sdc4-protein-mouse-hek-293-his.html
Purity
96.00
Smiles
ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTE
Molecular Formula
20971 (Gene_ID) O35988 (E24-E145) (Accession)
Molecular Weight
Approximately 19-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (MaxLight 750)
FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (MaxLight 750)
Hamster Interleukin 2 Receptor Alpha ELISA Kit
Hamster Interleukin 2 Receptor Alpha ELISA Kit
Hamster Interleukin 2 Receptor Alpha ELISA Kit